PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G01030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 304aa    MW: 33816.1 Da    PI: 6.9401
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G01030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.2e-1465112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed +lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  LPERR05G01030.1  65 KGPWTEQEDVQLVWFVRLFGERRWDFLAKVSGLKRTGKSCRLRWVNYL 112
                      79********************************************97 PP

2Myb_DNA-binding51.72e-16118163148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr T++E+ l+++++ q+G++ W++Iar ++ gRt++++k++w++++
  LPERR05G01030.1 118 RGRITADEERLILQLHSQWGSR-WSRIARSLP-GRTDNEIKNFWRTHM 163
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.29760112IPR017930Myb domain
SuperFamilySSF466893.63E-2763159IPR009057Homeodomain-like
SMARTSM007171.8E-1264114IPR001005SANT/Myb domain
PfamPF002498.0E-1365112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-1966119IPR009057Homeodomain-like
CDDcd001673.34E-967112No hitNo description
PROSITE profilePS5129423.561113167IPR017930Myb domain
SMARTSM007172.7E-15117165IPR001005SANT/Myb domain
PfamPF002495.4E-14118162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-23120165IPR009057Homeodomain-like
CDDcd001671.61E-10122163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MVGKKAKTAA MADQAEVEEE MMVMMMSGGG NQIKKSKNNL NLSSGDADDD VSGGGGRSGM  60
MMMRKGPWTE QEDVQLVWFV RLFGERRWDF LAKVSGLKRT GKSCRLRWVN YLHPGLKRGR  120
ITADEERLIL QLHSQWGSRW SRIARSLPGR TDNEIKNFWR THMRKLAHQS KTNKKMQSCS  180
SSSPATATPS SSLSSSLTSA TMTSSAITTR ALQESGGDDD AVDQMVAAPA TTTPASQQQQ  240
MDYTMEQLWN EIAAAETTSY VDDDAAAMAA AAASPVWEYC TDYSLWRIDD EEYYKKMMLD  300
GTLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-27621651103C-Myb DNA-Binding Domain
1msf_C3e-27621651103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0939216e-75AC093921.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0041A22, complete sequence.
GenBankAC1085046e-75AC108504.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1654_B10, complete sequence.
GenBankAK0992236e-75AK099223.1 Oryza sativa Japonica Group cDNA clone:J013091O17, full insert sequence.
GenBankAK1116346e-75AK111634.1 Oryza sativa Japonica Group cDNA clone:J013119H17, full insert sequence.
GenBankAP0149616e-75AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126136e-75CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960496.36e-89PREDICTED: myb-related protein MYBAS1-like
RefseqXP_014660308.17e-89PREDICTED: transcription factor MYB59-like
RefseqXP_015639553.16e-89PREDICTED: transcription factor MYB48
SwissprotQ4JL765e-68MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A0D9WC130.0A0A0D9WC13_9ORYZ; Uncharacterized protein
STRINGBGIOSGA019054-PA1e-115(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.37e-61myb domain protein 59